Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
This target displays homology in the following species: Human: 79%; Rat: 85%
Peptide sequence: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration is batch dependent: 0.5-1 mg/mL
AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ac-PA; achaete; achaete-scute; Achaete-scute complex protein T5; Achaete/Scute; acheate; achete; asc; CG3796-PA; hairy wing; Hairy-wing; Protein achaete
Gene Aliases: 990 E5 F1; AC; AS-C; AS-C T5; AS-C T5ac; ASC; ascT5; CG3796; Dmel\CG3796; Dmel_CG3796; EG:125H10.3; Hw; sc/T5; T5
UniProt ID: (Fruit fly) P10083
Entrez Gene ID: (Fruit fly) 30981
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support