Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
TBLR1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA1-29834
Applications
Tested Dilution
Publications
Product Specifications
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
synthetic peptide WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT, corresponding to amino acids 200-250 of Human TBLR1.
Conjugate
Form
Liquid
Concentration
0.5 mg/mL
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2199912
Product Specific Information
PA1-29834 detects TBLR1 from rat, mouse, human samples.
Target Information
Chromatin organization plays a fundamental role in regulating transcription in eukaryotic cells. The nuclear receptor corepressor (N-CoR) and silencing mediator of retinoid and thyroid hormone receptors (SMRT) play a role in diverse transcriptional repression pathways. N-CoR and SMRT each exist in large protein complexes, and are thought to mediate repression, at least in part, by their ability to recruit histone deacetylases to generate repressive chromatin. HDAC3 is the main HDAC that associates with N-CoR and SMRT complexes, and its presence is thought to be essential for repression. TBLR1 is a WD-40 repeat protein that also associates with N-CoR and SMRT complexes. Although TBLR1 is thought to be a core component of both the N-CoR and SMRT complexes, its role in these complexes remains to be elucidated.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support