Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
RNF2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-79929
Product Specifications
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RING2/ RING1B/RNF2.
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2747044
Product Specific Information
The synthetic peptide sequence is 257-290aa, DHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Target Information
RNF2 (E3 ubiquitin-protein ligase RING2) is a ligase that mediates monoubiquitination of Lys-119 of histone H2A (H2AK119Ub). Therefore, it plays a central role in histone code and gene regulation. The ligase activity is enhanced by BMI1/PCGF4. H2AK119Ub gives a specific tag for epigeneti transcriptional repression and participates in X chromosome inactivation of female mammals. RNF2 may be involved in the initiation of both imprinted and random X inactivation. RNF2 is also an essential component of a Polycomb group (PcG) multiprotein PRC1-like complex. This complex class is required to maintain the transcriptionally repressive state of many genes including Hox genes throughout development. The PcG PRC1 complex acts via chromatin remodeling and modification of histones and rendering chromatin heritably changed in its expressibility.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support