Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • RAB11A Antibodies

          Invitrogen

          RAB11A Monoclonal Antibody (4H9)

          View all (16) RAB11A antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite RAB11A Monoclonal Antibody (4H9)

          • Antibody Testing Data (7)
          RAB11A Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          RAB11A Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RAB11A Antibody (MA5-49197) in WB

          Western blot analysis of RAB11A using RAB11A Monoclonal Antibody (4H9) (Product # MA5-49197). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human 293T whole cell lysates. Lane 2: human SH-SY5Y whole cell lysates. Lane 3: human MCF-7 whole cell lysates. Lane 4: human Hela whole cell lysates. Lane 5: rat brain tissue lysates. Lane 6: rat PC-12 whole cell lysates. Lane 7: mouse brain ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RAB11A Antibody in Western Blot (WB)
          RAB11A Antibody in Flow Cytometry (Flow)
          RAB11A Antibody in Flow Cytometry (Flow)
          RAB11A Antibody in Flow Cytometry (Flow)
          RAB11A Antibody in Flow Cytometry (Flow)
          RAB11A Antibody in Flow Cytometry (Flow)
          RAB11A Antibody in Flow Cytometry (Flow)

          Product Details

          MA5-49197

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Mouse / IgG2b

          Class

          Monoclonal

          Type

          Antibody

          Clone

          4H9

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_3074855

          Product Specific Information

          Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

          Immunogen sequence is identical to the related mouse and rat sequences.

          Positive Control - WB: human 293T whole cell, human SH-SY5Y whole cell, human MCF-7 whole cell, human Hela whole cell, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse Neuro-2a whole cell. IHC: human spleen tissue, human gastric carcinoma tissue, human placenta tissue. ICC/IF: T-47D cell. Flow: ANA-1 cell, RH35 cell, U937 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Rab11A is a member of the YPT-1 subfamily of Ras-related GTP-binding proteins. Rab11A mRNA has been detected in a variety of tissues including brain, testis, spleen, heart, and gastrointestinal mucosa. In the gastric fundus the Rab11A protein is expressed in parietal cell tubulovesicles membranes. Expression of the Rab11A protein appears to occur in discrete epithelial cell populations where it localizes to apical vesicular populations. Recent studies have shown Rab11A is essential for resecretion of alpha-synuclein out of neuronal cells via endosome recycling and is required for exocytosis of discoidal/fusiform vesicles of bladder umbrella cells. Rab11A is also implicated in biogenesis of Birbeck granules and endosomal activation of the PI3K/AKT signaling pathway via G beta gamma trafficking.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 24KG; RAB 11A, member oncogene family; Rab-11; Ras-related protein Rab-11A; YL8

          View more View less

          Gene Aliases: RAB11; RAB11A; YL8

          View more View less

          UniProt ID: (Human) P62491, (Rat) P62494, (Mouse) P62492

          View more View less

          Entrez Gene ID: (Human) 8766, (Rat) 81830, (Mouse) 53869

          View more View less

          Function(s)
          GTPase activity protein binding GTP binding microtubule binding syntaxin binding myosin V binding GDP binding nucleotide binding
          Process(es)
          intracellular protein transport exocytosis mitotic metaphase plate congression metabolic process positive regulation of epithelial cell migration regulation of multivesicular body size positive regulation of G2/M transition of mitotic cell cycle vesicle-mediated transport astral microtubule organization neuron projection development melanosome transport Rab protein signal transduction multivesicular body assembly positive regulation of axon extension regulation of long-term neuronal synaptic plasticity regulation of protein transport establishment of vesicle localization regulation of vesicle-mediated transport establishment of protein localization to organelle protein localization to plasma membrane establishment of protein localization to membrane mitotic spindle assembly exosomal secretion cytokinesis renal water homeostasis small GTPase mediated signal transduction protein transport plasma membrane to endosome transport transport cell cycle
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-66966984d8-2vwff:80/100.66.134.75:80.
          git-commit: 4f7892df6eac4c3aaa23131f1084e28be0ddeb54
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.33.0-2025.07.30-1.0