Invitrogen

PDPK1 Polyclonal Antibody

View all (46) PDPK1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Product Details

PA5-79801

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunohistochemistry (Frozen) (IHC (F))

0.5-1 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746916

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: Rat Liver Tissue, Rat Lung Tissue, Mouse Liver Tissue, Mouse Lung Tissue, COLO320 whole cell, MCF-7 whole cell. IHC: Mouse Intestine tissue, Rat Testis tissue, Human Lung Cancer tissue IHC-F: human placenta tissue, mouse small intestine tissue.

Target Information

PDPK1 (3 Phosphoinositide Dependent Protein Kinase 1) phosphorylates AGC kinases. PDPK1 activates conventional PKC and PKC zeta through phosphorylation of critical threonine residues in the activation loop. PDPK1 also phosphorylates Protein Kinase B (PKB) at threonine 308 in the presence of phosphatidylinositol-3,4,5-trisphosphate. Active Akt inactivates Glycogen Synthase Kinase 3 (GSK3), eventually leading to the dephosphorylation and activation of glycogen synthase, and the stimulation of glycogen synthesis. Because of the role that PDPK1 plays in insulin-induced glycogen synthesis and PKC activation, it is a potentially important target for metabolic drug research.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: 3-phosphoinositide dependent protein kinase-1; 3-phosphoinositide-dependent protein kinase 1; 3-phosphoinositide-dependent protein kinase 2 pseudogene; HGNC:8809; hPDK1; isoenzyme 1; kinase isoenzyme 1; lipoamide; mPDK1; OTTHUMP00000174525; OTTHUMP00000205076; PkB kinase; PkB kinase like gene 1; PkB-like 1; Protein kinase B kinase

View more View less

Gene Aliases: PDK1; PDPK1; PDPK2; PDPK2P; PRO0461

View more View less

UniProt ID: (Human) O15530, (Mouse) Q9Z2A0, (Rat) O55173

View more View less

Entrez Gene ID: (Human) 5170, (Mouse) 18607, (Rat) 81745

View more View less

Function(s)
protein serine/threonine kinase activity 3-phosphoinositide-dependent protein kinase activity insulin receptor binding protein binding ATP binding phospholipase activator activity kinase activity protein kinase binding phospholipase binding nucleotide binding protein kinase activity transferase activity transferase activity, transferring phosphorus-containing groups
Process(es)
type B pancreatic cell development transcription, DNA-templated regulation of transcription, DNA-templated protein phosphorylation negative regulation of protein kinase activity hyperosmotic response signal transduction epidermal growth factor receptor signaling pathway positive regulation of phospholipase activity regulation of endothelial cell migration negative regulation of cardiac muscle cell apoptotic process phosphorylation cell migration peptidyl-threonine phosphorylation calcium-mediated signaling negative regulation of transforming growth factor beta receptor signaling pathway activation of protein kinase B activity cellular response to insulin stimulus negative regulation of toll-like receptor signaling pathway regulation of I-kappaB kinase/NF-kappaB signaling regulation of mast cell degranulation focal adhesion assembly positive regulation of release of sequestered calcium ion into cytosol cellular response to epidermal growth factor stimulus positive regulation of establishment of protein localization to plasma membrane extrinsic apoptotic signaling pathway stimulatory C-type lectin receptor signaling pathway peptidyl-serine phosphorylation actin cytoskeleton organization platelet activation T cell costimulation intracellular signal transduction Fc-epsilon receptor signaling pathway protein autophosphorylation phosphatidylinositol-mediated signaling T cell receptor signaling pathway
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support