Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Peptide Sequence: STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW
Sequence homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Nucleoporin Nup35 or Mitotic phosphoprotein 44 is a nuclear protein known to be present on nuclear pore complex and is tightly associated with the nuclear membrane and lamina. This RNA associated protein belongs to the Nup53 family and has a MPPN (mitotic phosphoprotein N' end) domain. It has a small number of scattered phenylalanine-glycine repeats, but not the large domains seen in other nucleoporins. Though the exact function of NUP35 is yet to be revealed, it may function as a component of the nuclear pore complex (NPC) which are collectively referred to as nucleoporins (NUPs). It also may play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors, and may also play an important part in the association of MAD1, a transcriptional repressor with the NPC. NUP35 is widely expressed in most of the tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support