Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • MEF2C Antibodies

          Invitrogen

          MEF2C Polyclonal Antibody

          View all (67) MEF2C antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite MEF2C Polyclonal Antibody

          • Antibody Testing Data (2)
          MEF2C Antibody in Flow Cytometry (Flow)
          Group 53 Created with Sketch.
          MEF2C Antibody in Flow Cytometry (Flow)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          MEF2C Antibody (PA5-95568) in Flow

          Flow cytometry analysis of MEF2C in HELA cells using MEF2C Polyclonal Antibody (Product # PA5-95568), shown in overlay histogram (blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum, and incubated with the primary antibody (1 μg/1x10^6 cells) for 30 min at 20°C. DyLight 488 conjugated goat anti-rabbit IgG (5-10 µg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibo... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          MEF2C Antibody in Flow Cytometry (Flow)
          MEF2C Antibody in Flow Cytometry (Flow)

          Product Details

          PA5-95568

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Wet ice

          RRID

          AB_2807370

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human K562 whole cell, human COLO320 whole cell, human DAUDI whole cell, human U937 whole cell, rat brain tissue. IHC: human tonsil tissue, rat brain tissue, mouse brain tissue. Flow: HELA cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          MEF2C is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: MADS box transcription enhancer factor 2, polypeptide C; Myocyte enhancer factor 2C; Myocyte-specific enhancer factor 2C

          View more View less

          Gene Aliases: 5430401D19Rik; 9930028G15Rik; AV011172; C5DELq14.3; DEL5q14.3; Mef2; MEF2C; RGD1563119

          View more View less

          UniProt ID: (Human) Q06413, (Rat) A0A096MJY4, (Mouse) Q8CFN5

          View more View less

          Entrez Gene ID: (Human) 4208, (Rat) 499497, (Mouse) 17260

          View more View less

          Function(s)
          RNA polymerase II regulatory region sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II distal enhancer sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding transcription factor activity, RNA polymerase II core promoter sequence-specific core promoter sequence-specific DNA binding transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding AT DNA binding chromatin binding transcription factor activity, sequence-specific DNA binding protein binding activating transcription factor binding miRNA binding histone deacetylase binding transcription regulatory region DNA binding protein heterodimerization activity HMG box domain binding core promoter proximal region sequence-specific DNA binding DNA binding transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding sequence-specific DNA binding protein dimerization activity
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter MAPK cascade blood vessel development osteoblast differentiation neuron migration B cell homeostasis heart looping endochondral ossification blood vessel remodeling chondrocyte differentiation germinal center formation regulation of germinal center formation primary heart field specification secondary heart field specification outflow tract morphogenesis sinoatrial valve morphogenesis cardiac ventricle formation regulation of transcription, DNA-templated transcription from RNA polymerase II promoter apoptotic process humoral immune response nervous system development heart development muscle organ development skeletal muscle tissue development muscle cell fate determination learning or memory response to virus positive regulation of gene expression negative regulation of gene expression positive regulation of alkaline phosphatase activity neural crest cell differentiation cardiac muscle hypertrophy in response to stress myotube differentiation neuron differentiation platelet formation monocyte differentiation negative regulation of ossification melanocyte differentiation positive regulation of bone mineralization positive regulation of B cell proliferation cellular response to drug skeletal muscle cell differentiation cellular response to trichostatin A B cell proliferation regulation of neuron apoptotic process negative regulation of neuron apoptotic process regulation of megakaryocyte differentiation positive regulation of myoblast differentiation positive regulation of neuron differentiation positive regulation of osteoblast differentiation positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter regulation of neurotransmitter secretion regulation of synaptic plasticity positive regulation of skeletal muscle tissue development neuron development cell morphogenesis involved in neuron differentiation embryonic viscerocranium morphogenesis negative regulation of epithelial cell proliferation B cell receptor signaling pathway smooth muscle cell differentiation positive regulation of muscle cell differentiation regulation of synapse assembly regulation of synaptic transmission, glutamatergic ventricular cardiac muscle cell differentiation palate development regulation of synaptic activity positive regulation of cardiac muscle cell proliferation excitatory postsynaptic potential regulation of sarcomere organization cartilage morphogenesis regulation of dendritic spine development renal tubule morphogenesis cellular response to lipopolysaccharide cellular response to calcium ion cellular response to parathyroid hormone stimulus cellular response to fluid shear stress cellular response to transforming growth factor beta stimulus positive regulation of cell proliferation in bone marrow glomerulus morphogenesis nephron tubule epithelial cell differentiation positive regulation of protein homodimerization activity positive regulation of macrophage apoptotic process regulation of N-methyl-D-aspartate selective glutamate receptor activity regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity positive regulation of cardiac muscle cell differentiation positive regulation of behavioral fear response epithelial cell proliferation involved in renal tubule morphogenesis positive regulation of skeletal muscle cell differentiation response to ischemia positive regulation of cardiac muscle hypertrophy dentate gyrus development response to nutrient levels response to vitamin E positive regulation of MAP kinase activity cell fate commitment embryonic skeletal system morphogenesis cardiac muscle cell differentiation transdifferentiation cellular response to retinoic acid cellular response to glucose stimulus cellular response to growth factor stimulus cellular response to organic cyclic compound transcription, DNA-templated multicellular organism development cell differentiation
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-74d457f4b4-shh8z:80/100.66.134.75:80.
          git-commit: 8f686215b626e88a2c994180c6d6ff457de4eb41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: integration/2.33.0-meta-desc