Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • Lyn Antibodies

          Invitrogen

          Lyn Polyclonal Antibody

          View all (44) Lyn antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite Lyn Polyclonal Antibody

          Product Details

          PA5-95460

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Wet ice

          RRID

          AB_2807263

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human 293T whole cell. IHC: mouse intestine tissue, rat spleen tissue, human tonsil tissue, mouse spleen tissue, rat lymphaden tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: FLJ26625; Lck/Yes-related novel protein tyrosine kinase; lyn protein non-receptor kinase; p53Lyn; p56Lyn; Tyrosine-protein kinase Lyn; V-yes-1 Yamaguchi sarcoma viral related oncogene homolog; Yamaguchi sarcoma viral (v-yes-1) oncogene homolog

          View more View less

          Gene Aliases: AA407514; Hck-2; JTK8; LYN; p53Lyn; p56Lyn

          View more View less

          UniProt ID: (Human) P07948, (Mouse) P25911, (Rat) Q07014

          View more View less

          Entrez Gene ID: (Human) 4067, (Mouse) 17096, (Rat) 81515

          View more View less

          Function(s)
          protein tyrosine kinase activity non-membrane spanning protein tyrosine kinase activity receptor signaling protein tyrosine kinase activity receptor binding platelet-derived growth factor receptor binding integrin binding protein binding ATP binding SH3 domain binding ubiquitin protein ligase binding gamma-tubulin binding glycosphingolipid binding ion channel binding phosphoprotein binding nucleotide binding protein kinase activity erythropoietin receptor binding kinase activity transferase activity transferase activity, transferring phosphorus-containing groups enzyme binding protein complex binding
          Process(es)
          B cell homeostasis regulation of cytokine production negative regulation of protein phosphorylation immune system process Fc receptor mediated stimulatory signaling pathway tolerance induction to self antigen histamine secretion by mast cell platelet degranulation negative regulation of myeloid leukocyte differentiation immune response-regulating cell surface receptor signaling pathway Fc receptor mediated inhibitory signaling pathway regulation of B cell apoptotic process protein phosphorylation inflammatory response cellular response to DNA damage stimulus signal transduction transmembrane receptor protein tyrosine kinase signaling pathway positive regulation of cell proliferation negative regulation of cell proliferation response to hormone positive regulation of neuron projection development phosphorylation peptidyl-tyrosine phosphorylation hemopoiesis erythrocyte differentiation positive regulation of cell migration negative regulation of B cell proliferation neuron projection development lipopolysaccharide-mediated signaling pathway regulation of mast cell activation regulation of cell adhesion mediated by integrin negative regulation of toll-like receptor 2 signaling pathway negative regulation of toll-like receptor 4 signaling pathway intracellular signal transduction peptidyl-tyrosine autophosphorylation positive regulation of phosphorylation positive regulation of tyrosine phosphorylation of STAT protein hemoglobin biosynthetic process regulation of mast cell degranulation negative regulation of MAP kinase activity positive regulation of phosphatidylinositol 3-kinase activity innate immune response regulation of erythrocyte differentiation protein autophosphorylation cytokine secretion regulation of cytokine secretion regulation of inflammatory response positive regulation of peptidyl-tyrosine phosphorylation B cell receptor signaling pathway regulation of B cell receptor signaling pathway positive regulation of B cell receptor signaling pathway positive regulation of cellular component movement regulation of release of sequestered calcium ion into cytosol positive regulation of glial cell proliferation positive regulation of Fc receptor mediated stimulatory signaling pathway positive regulation of stress-activated protein kinase signaling cascade regulation of ERK1 and ERK2 cascade negative regulation of ERK1 and ERK2 cascade positive regulation of oligodendrocyte progenitor proliferation negative regulation of mast cell proliferation positive regulation of mast cell proliferation cellular response to retinoic acid cellular response to peptide hormone stimulus regulation of monocyte chemotaxis regulation of platelet aggregation dendritic cell differentiation negative regulation of intracellular signal transduction positive regulation of dendritic cell apoptotic process regulation of protein phosphorylation stimulatory C-type lectin receptor signaling pathway adaptive immune response response to sterol depletion central nervous system development blood coagulation response to toxic substance response to carbohydrate oligodendrocyte development response to organic cyclic compound viral process signal transduction by protein phosphorylation platelet activation T cell costimulation cellular response to extracellular stimulus response to insulin cellular response to heat Fc-epsilon receptor signaling pathway Fc-gamma receptor signaling pathway involved in phagocytosis response to drug response to amino acid ephrin receptor signaling pathway response to axon injury negative regulation of immune response leukocyte migration JAK-STAT cascade involved in growth hormone signaling pathway chemotaxis cell migration response to peptide hormone
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-89bfcd4dd-zgn5p:80/100.66.134.75:80.
          git-commit: f1ed3cb73da2dc18796bd96aca0ec275a318700b
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.33.0-2025.07.30-1.0