Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • IL17RE Antibodies

          Invitrogen

          IL17RE Monoclonal Antibody (46N7E3)

          View all (6) IL17RE antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite IL17RE Monoclonal Antibody (46N7E3)

          • Antibody Testing Data (2)
          IL17RE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          IL17RE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IL17RE Antibody (MA5-24806) in IHC (P)

          Immunohistochemical analysis of IL17RE in formalin-fixed, paraffin-embedded human kidney tissue. Samples were incubated in IL17RE monoclonal antibody (Product # MA5-24806) using a dilution of 10 µg/mL. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IL17RE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IL17RE Antibody in Western Blot (WB)

          Product Details

          MA5-24806

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          5-10 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          10 µg/mL
          -

          Flow Cytometry (Flow)

          5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Mouse / IgG2b, kappa

          Class

          Monoclonal

          Type

          Antibody

          Clone

          46N7E3

          Immunogen

          Recombinant human IL17E which corresponds to Amino acids (97-199).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          0.5 mg/mL

          Purification

          Protein G

          Storage buffer

          PBS with 0.05% BSA

          Contains

          0.05% sodium azide

          Storage conditions

          Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2717279

          Product Specific Information

          Immunogen amino acids (97-199) contain the sequence MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE.

          Target Information

          The interleukin 17 receptor E (IL-17RE) shares limited similarity to the receptor of IL-17A, a ubiquitous type I membrane glycoprotein that with IL-17A plays a pathogenic role in many inflammatory and autoimmune diseases such as rheumatoid arthritis. IL-17RE is the functional receptor of IL-17C and has been suggested to mediate mucosal immunity to infection with intestinal pathogens. IL-17C is produced by epithelia in response to bacterial challenge and binds to a receptor complex formed by IL-17RE and IL-17RA on the epithelial cell surface, thereby regulating the immune function of epithelial cells in an autocrine manner.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: IL-17 receptor E; Interleukin-17 receptor E

          View more View less

          Gene Aliases: IL17RE; UNQ3056/PRO9877

          View more View less

          UniProt ID: (Human) Q8NFR9

          View more View less

          Entrez Gene ID: (Human) 132014

          View more View less

          Function(s)
          protein binding interleukin-17 receptor activity
          Process(es)
          inflammatory response cytokine-mediated signaling pathway
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-89bfcd4dd-zgn5p:80/100.66.134.75:80.
          git-commit: f1ed3cb73da2dc18796bd96aca0ec275a318700b
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.33.0-2025.07.30-1.0