Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ICA1L Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA1-28315
Product Specifications
Host/Isotype
Chicken
/ IgY
Class
Polyclonal
Type
Antibody
Immunogen
Fusion protein: levfhsvqetctellkiiekyqlrlnviseeenelglflkfqaerdatqagkmmdatgkalcssakqrlalctplsrlkqevatfsqravsdtlmt, corresponding to amino acids 53-148 of Human Ica69-related protein/LOC130026.
Conjugate
Form
Liquid
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
Product Specific Information
PA1-28315 detects ICA1L from human samples.
PA1-28315 has been successfully used in Western blot applications.
The PA1-28315 immunogen is: Fusion protein: levfhsvqetctellkiiekyqlrlnviseeenelglflkfqaerdatqagkmmdatgkalcssakqrlalctplsrlkqevatfsqravsdtlmt, corresponding to amino acids 53-148 of Human Ica69-related protein/LOC130026.
Target Information
ICA1L is a protein coding gene and gene ontology (GO) annotation includes acrosomal vesicle; protein domain specific binding; spermatid development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support