Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • HMGB1 Antibodies

          Invitrogen

          HMGB1 Polyclonal Antibody

          Advanced Verification
          View all (56) HMGB1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite HMGB1 Polyclonal Antibody

          • Antibody Testing Data (6)
          • Advanced Verification (1)
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HMGB1 Antibody (PA5-79373) in ICC/IF

          Immunocytochemistry/Immunofluorescence analysis of HMGB1 in U20S cells using HMGB1 Polyclonal Antibody (Product # PA5-79373). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 2 µg/mL. DyLight 594 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter set... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HMGB1 Antibody in Immunocytochemistry (ICC/IF)
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Western Blot (WB)
          HMGB1 Antibody in Flow Cytometry (Flow)
          HMGB1 Antibody

          Product Details

          PA5-79373

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746489

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, rat brain tissue, mouse brain tissue, mouse RAW264.7 whole cell. IHC: mouse intestine tissue, mouse liver tissue, rat intestine tissue, rat liver tissue, human mammary cancer tissue, human placenta tissue,. ICC/IF: U20S cell, A431 cell. Flow: THP-1 cell.

          Target Information

          HMGB1 (High-mobility group box-1) protein was originally described as a nuclear non-histone DNA binding chromosomal protein. However, recent studies indicate that damaged, necrotic cells liberate HMGB1 into the extracellular milieu where it functions as a proinflammatory cytokine. Mouse HMGB1 is expressed as a 215 amino acid single chain polypeptide containing three domains: two tandem-linked positively charged DNA-binding domains (HMG box A, aa 9-79; and box B, aa 89-162), and a negatively charged 30 aa C-terminal acidic tail region. Residues 28 - 44 and 180 - 185 contain a nuclear localization signal (NLS). The cytokine activity of HMGB1 is contained in the B box, while the A box is associated with the helix-loop-helix domain of transcription factors. HMGB1 acts both as an inflammatory mediator that promotes monocyte migration and cytokine secretion, as well as a mediator of T cell-dendritic cell interaction. HMGB1 is secreted and acts to transduce cellular signals through its high affinity receptor, RAGE and possibly, TLR2 and TLR4. HMGB1 is highly conserved and ubiquitous in the nuclei and cytoplasm of nearly all cell types, is a necessary and sufficient mediator of inflammation during sterile and infection-associated responses. HMGB1 also act as DNA nuclear binding protein that has recently been shown to be an early trigger of sterile inflammation in animal models of trauma-hemorrhage via the activation of the Toll-like receptor 4 (TLR4) and the receptor for the advanced glycation endproducts (RAGE). Moreover, HMGB1 is reported that the level of HMGB1 is elevated during sterile tissue injury, infection, lethal endotoxemia or sepsis, collagen-induced arthritis, and ischemia-reperfusion induced tissue injury.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Amphoterin; Amphoterin antibody; DKFZp686A04236; Heparin-binding protein p30; high mobility group 1; High mobility group protein 1; High mobility group protein B1; high-mobility group (nonhistone chromosomal) protein 1; high-mobility group box 1; HMG-1; HMG3 antibody; hmgb 1; hmgb-1; RP11-550P23.1; Sulfoglucuronyl carbohydrate binding protein

          View more View less

          Gene Aliases: Ac2-008; amphoterin; DEF; HMG-1; HMG1; HMG3; HMGB1; p30; SBP-1

          View more View less

          UniProt ID: (Human) P09429, (Rat) P63159, (Mouse) P63158

          View more View less

          Entrez Gene ID: (Human) 3146, (Rat) 25459, (Mouse) 15289

          View more View less

          Function(s)
          four-way junction DNA binding bubble DNA binding lipopolysaccharide binding phosphatidylserine binding damaged DNA binding double-stranded DNA binding single-stranded DNA binding transcription factor activity, sequence-specific DNA binding double-stranded RNA binding single-stranded RNA binding cytokine activity protein binding transcription factor binding DNA binding, bending calcium-dependent protein kinase regulator activity lyase activity C-X-C chemokine binding protein kinase activator activity chemoattractant activity poly(A) RNA binding RAGE receptor binding DNA polymerase binding repressing transcription factor binding supercoiled DNA binding open form four-way junction DNA binding crossed form four-way junction DNA binding DNA binding bent DNA binding chromatin binding 5S rRNA binding heparin binding peptide binding protein dimerization activity glycolipid binding
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter eye development myeloid dendritic cell activation endothelial cell proliferation activation of innate immune response plasmacytoid dendritic cell activation macrophage activation involved in immune response dendritic cell chemotaxis inflammatory response to antigenic stimulus regulation of tolerance induction regulation of T cell mediated immune response to tumor cell DNA topological change base-excision repair apoptotic DNA fragmentation DNA recombination regulation of transcription from RNA polymerase II promoter autophagy inflammatory response positive regulation of cytosolic calcium ion concentration regulation of autophagy negative regulation of RNA polymerase II transcriptional preinitiation complex assembly lung development neuron projection development chromatin assembly regulation of restriction endodeoxyribonuclease activity activation of protein kinase activity DNA geometric change positive regulation of mismatch repair negative regulation of interferon-gamma production positive regulation of interferon-alpha production positive regulation of interferon-beta production positive regulation of interleukin-10 production positive regulation of interleukin-12 production positive regulation of tumor necrosis factor production V(D)J recombination positive regulation of toll-like receptor 2 signaling pathway positive regulation of toll-like receptor 4 signaling pathway positive regulation of toll-like receptor 9 signaling pathway T-helper 1 cell activation endothelial cell chemotaxis positive regulation of activated T cell proliferation positive regulation of apoptotic process apoptotic cell clearance positive regulation of cysteine-type endopeptidase activity involved in apoptotic process negative regulation of CD4-positive, alpha-beta T cell differentiation positive regulation of DNA binding positive regulation of MAPK cascade negative regulation of blood vessel endothelial cell migration T-helper 1 cell differentiation innate immune response positive regulation of myeloid cell differentiation positive regulation of glycogen catabolic process positive regulation of transcription from RNA polymerase II promoter positive regulation of JNK cascade positive regulation of interleukin-1 secretion positive regulation of interleukin-1 beta secretion positive chemotaxis DNA ligation involved in DNA repair positive regulation of DNA ligation response to glucocorticoid positive regulation of ERK1 and ERK2 cascade positive regulation of monocyte chemotaxis positive regulation of wound healing neutrophil clearance positive regulation of NIK/NF-kappaB signaling positive regulation of sprouting angiogenesis tumor necrosis factor secretion negative regulation of apoptotic cell clearance positive regulation of interleukin-6 secretion regulation of nucleotide-excision repair positive regulation of dendritic cell differentiation cell morphogenesis positive regulation of protein phosphorylation positive regulation of mesenchymal cell proliferation base-excision repair, DNA ligation chromatin remodeling regulation of transcription, DNA-templated chemotaxis nervous system development circadian rhythm negative regulation of DNA replication positive regulation of cell proliferation response to heat response to glucose positive regulation of cell death positive regulation of neuron projection development positive regulation of smooth muscle cell migration positive regulation of cell migration actin cytoskeleton reorganization response to lipopolysaccharide response to insulin positive regulation of myeloid cell apoptotic process response to interferon-gamma response to drug positive regulation of myoblast differentiation positive regulation of protein kinase activity positive regulation of mitotic cell cycle regulation of inflammatory response male-specific defense response to bacterium induction of positive chemotaxis myoblast proliferation cellular response to interleukin-1
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-666774c847-7p7bh:80/100.66.135.138:80.
          git-commit: 4f7bff5b1d64937db6e1726f71785770340a1908
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.34.0-2025.08.32-1.0