Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • FGF8 Antibodies

          Abnova

          FGF8 Monoclonal Antibody (2A11)

          View all (17) FGF8 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite FGF8 Monoclonal Antibody (2A11)

          • Antibody Testing Data (2)
          FGF8 Antibody in ELISA (ELISA)
          Group 53 Created with Sketch.
          FGF8 Antibody in ELISA (ELISA)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          FGF8 Antibody (H00002253-M05) in ELISA

          Detection limit for recombinant GST tagged FGF8 is approximately 0.3 ng/mL as a capture antibody. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          FGF8 Antibody in ELISA (ELISA)
          FGF8 Antibody in Proximity Ligation Assay (PLA) (PLA)

          Product Details

          H00002253-M05

          Applications
          Tested Dilution
          Publications

          ELISA (ELISA)

          0.3 ng/mL
          -

          in situ PLA (PLA)

          1:1200
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Mouse / IgG2a, kappa

          Class

          Monoclonal

          Type

          Antibody

          Clone

          2A11

          Immunogen

          FGF8 (NP_149354, 65 a.a. approximately 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          See Label

          Purification

          Affinity chromatography

          Storage buffer

          PBS, pH 7.4

          Contains

          no preservative

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Product Specific Information

          Sequence of this protein is as follows: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK

          Target Information

          Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: AIGF; androgen-induced; Androgen-induced growth factor; FGF; FGF-8; Fibroblast growth factor; Fibroblast growth factor 8; fibroblast growth factor 8 (androgen-induced); HBGF-8; Heparin-binding growth factor 8; MGC149376

          View more View less

          Gene Aliases: AIGF; FGF-8; FGF8; HBGF-8; HH6; KAL6

          View more View less

          UniProt ID: (Human) P55075

          View more View less

          Entrez Gene ID: (Human) 2253

          View more View less

          Function(s)
          protein tyrosine kinase activity Ras guanyl-nucleotide exchange factor activity fibroblast growth factor receptor binding growth factor activity 1-phosphatidylinositol-3-kinase activity chemoattractant activity phosphatidylinositol-4,5-bisphosphate 3-kinase activity
          Process(es)
          MAPK cascade patterning of blood vessels metanephros development branching involved in ureteric bud morphogenesis organ induction mesonephros development neural plate morphogenesis heart looping blood vessel remodeling outflow tract septum morphogenesis epithelial to mesenchymal transition involved in endocardial cushion formation apoptotic process response to oxidative stress gastrulation motor neuron axon guidance mesodermal cell migration positive regulation of cell proliferation gonad development fibroblast growth factor receptor signaling pathway anatomical structure morphogenesis positive regulation of gene expression regulation of phosphatidylinositol 3-kinase signaling response to organic cyclic compound peptidyl-tyrosine phosphorylation pallium development subpallium development forebrain dorsal/ventral pattern formation cell proliferation in forebrain forebrain neuron development signal transduction involved in regulation of gene expression BMP signaling pathway male genitalia development thyroid gland development otic vesicle formation midbrain-hindbrain boundary development dorsal/ventral axon guidance embryonic hindlimb morphogenesis aorta morphogenesis phosphatidylinositol-3-phosphate biosynthetic process odontogenesis regulation of odontogenesis of dentin-containing tooth response to drug negative regulation of neuron apoptotic process positive regulation of GTPase activity cell fate commitment positive regulation of mitotic nuclear division positive regulation of organ growth phosphatidylinositol phosphorylation phosphatidylinositol-mediated signaling forebrain morphogenesis positive chemotaxis positive regulation of cell division negative regulation of cardiac muscle tissue development pharyngeal system development canonical Wnt signaling pathway corticotropin hormone secreting cell differentiation thyroid-stimulating hormone-secreting cell differentiation bone development lung morphogenesis branching involved in salivary gland morphogenesis neuroepithelial cell differentiation positive regulation of ERK1 and ERK2 cascade dopaminergic neuron differentiation cell migration involved in mesendoderm migration
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-6964b85fdd-nnkpd:80/100.66.134.75:80.
          git-commit: 018d2145e570c4512be1986d436cde5fa884f61c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.33.0-2025.07.30-1.0