Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • ETV4 Antibodies

          Invitrogen

          ETV4 Polyclonal Antibody

          View all (22) ETV4 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite ETV4 Polyclonal Antibody

          Product Details

          PA5-79223

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746339

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Lung Tissue, HELA whole cell, A549 whole cell, SW620 whole cell.

          Target Information

          ETV4: ets variant gene 4 (E1A enhancer binding protein, E1AF), also known as PEA3. Several members of the Ets gene family are known to encode sequencespecific DNA binding proteins. These include mouse PU. 1, mouse and human Ets-1, Drosophila E74, chicken and human Ets-2 and rat GABP-a. Each of these proteins recognizes similar motifs in DNA that share a centrally located 5'-GGAA-3' element. For instance, PEA3 binds the motif 5'-AGGAAG-3' (the PEA-3 motif), but does not bind to the sequence 5'-AGGAAC-3', recognized by PU. 1, although PU. 1 binds equally well to both sequences. It appears that all of the Ets proteins recognize the same central core sequence but that each protein interacts with unique sequences that flank this core. PEA3 is expressed at readily detectable levels in cells of epithelial and fibroblastic origin but is not expressed in hematopoietic cells. This is in contrast to other members of the Ets gene family, such as Ets-1, Ets-2 and Fli-1, each of which is expressed primarily in cells of hematopoietic origin.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Adenovirus E1A enhancer-binding protein; E1A F; E1A-F; ETS translocation variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ets variant gene 4 (E1A enhancer-binding protein, E1AF); EWS protein/E1A enhancer binding protein chimera; PEA3 protein; Polyomavirus enhancer activator 3 homolog; polyomavirus enhancer activator-3; Protein PEA3

          View more View less

          Gene Aliases: E1A-F; E1AF; ETV4; PEA3; PEAS3

          View more View less

          UniProt ID: (Human) P43268

          View more View less

          Entrez Gene ID: (Human) 2118, (Rat) 360635

          View more View less

          Function(s)
          RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding protein binding DNA binding
          Process(es)
          transcription from RNA polymerase II promoter motor neuron axon guidance cell differentiation negative regulation of mammary gland epithelial cell proliferation positive regulation of transcription from RNA polymerase II promoter stem cell differentiation branching involved in mammary gland duct morphogenesis regulation of branching involved in mammary gland duct morphogenesis regulation of transcription from RNA polymerase II promoter positive regulation of gene expression positive regulation of transcription, DNA-templated
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-89bfcd4dd-zgn5p:80/100.66.134.75:80.
          git-commit: f1ed3cb73da2dc18796bd96aca0ec275a318700b
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.33.0-2025.07.30-1.0