Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The synthetic peptide sequence is 162-194aa, DLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Corticotropin Releasing Factor (CRF), a 41 amino acids neuropeptide, belongs to a family of structurally related peptides including urocortin, sauvagine and urotensin I. CRF is critical in the regulation of the pituitary-adrenal gland axis, and in endocrine, autonomic and behavioral responses to stress. CRF is widely distributed in the brain and peripheral nervous system with the highest levels in the hypothalamic paraventricular nucleus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support