Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • Aquaporin 1 Antibodies

          Invitrogen

          Aquaporin 1 Polyclonal Antibody

          2 Published Figures
          2 References
          View all (33) Aquaporin 1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite Aquaporin 1 Polyclonal Antibody

          • Antibody Testing Data (6)
          • Published Figures (2)
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 8

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Aquaporin 1 Antibody (PA5-78806) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of Aquaporin 1 in paraffin-embedded section of rat kidney tissue using Aquaporin 1 Polyclonal Antibody (Product # PA5-78806). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overni... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Western Blot (WB)
          Aquaporin 1 Antibody in Flow Cytometry (Flow)
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry, Immunohistochemistry (Paraffin) (IHC, IHC (P))

          Product Details

          PA5-78806

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          View 1 publication 1 publication

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745922

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat heart tissue, rat kidney tissue, rat lung tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue. IHC: human kidney tissue, mouse kidney tissue, rat kidney tissue. Flow: U2OS cell.

          Target Information

          Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: AQP 1; AQP CHIP; AQP-1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel-like integral membrane protein of 28 kDa; channel-like integral membrane protein, 28-kDa; CHIP 28; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; MGC26324; Urine water channel; water channel protein for red blood cells and kidney proximal tubule

          View more View less

          Gene Aliases: AQP-CHIP; AQP1; CHIP28; CO

          View more View less

          UniProt ID: (Human) P29972, (Mouse) Q02013, (Rat) P29975

          View more View less

          Entrez Gene ID: (Human) 358, (Mouse) 11826, (Rat) 25240

          View more View less

          Function(s)
          intracellular cGMP activated cation channel activity potassium channel activity water transmembrane transporter activity protein binding ammonium transmembrane transporter activity potassium ion transmembrane transporter activity glycerol transmembrane transporter activity water channel activity glycerol channel activity transmembrane transporter activity nitric oxide transmembrane transporter activity carbon dioxide transmembrane transporter activity transporter activity ephrin receptor binding
          Process(es)
          renal water homeostasis renal water transport cGMP biosynthetic process potassium ion transport water transport cell volume homeostasis cellular water homeostasis carbon dioxide transport ammonium transport bicarbonate transport glycerol transport cellular homeostasis lateral ventricle development pancreatic juice secretion nitric oxide transport establishment or maintenance of actin cytoskeleton polarity cerebrospinal fluid secretion cellular response to stress cellular response to UV transepithelial water transport carbon dioxide transmembrane transport odontogenesis response to drug negative regulation of apoptotic process negative regulation of cysteine-type endopeptidase activity involved in apoptotic process positive regulation of angiogenesis positive regulation of saliva secretion positive regulation of fibroblast proliferation multicellular organismal water homeostasis cellular response to hydrogen peroxide cellular response to inorganic substance cellular response to mechanical stimulus cellular response to copper ion cellular response to mercury ion cellular response to retinoic acid cellular response to cAMP cellular response to hypoxia cellular response to salt stress cellular hyperosmotic response cellular response to dexamethasone stimulus cellular response to nitric oxide potassium ion transmembrane transport ammonium transmembrane transport maintenance of symbiont-containing vacuole by host glomerular filtration transport positive regulation of lamellipodium assembly positive regulation of epithelial cell migration organic cation transport sensory perception of pain water homeostasis positive regulation of cell migration secretion by cell secretory granule organization carbohydrate transmembrane transport wound healing lipid digestion camera-type eye morphogenesis corticotropin secretion transmembrane transport renal water absorption cation transmembrane transport hyperosmotic response response to hormone hyperosmotic salinity response response to estrogen metanephric descending thin limb development metanephric proximal straight tubule development metanephric proximal convoluted tubule segment 2 development metanephric glomerulus vasculature development
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-7dfb8678b5-vqhv7:80/100.66.129.46:80.
          git-commit: 632cddff25488e9c1007a93c87c1899f725eef0d
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.34.0-2025.08.32-1.0