Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • SLC25A5 Antibodies

          Fabgennix

          Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC

          View all (12) SLC25A5 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC

          Product Details

          ANT2-FITC

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:500-1:1,000
          -

          Immunohistochemistry (IHC)

          1:50-1:250
          -

          Immunocytochemistry (ICC/IF)

          1:50-1:250
          -

          ELISA (ELISA)

          1:10,000
          -

          Immunoprecipitation (IP)

          1:50-1:250
          -

          Immunomicroscopy (IM)

          1:50-1:200
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.Sequence:AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
          View immunogen

          Conjugate

          FITC FITC FITC

          Excitation/Emission Max

          498/517 nm View spectra spectra

          Form

          Liquid

          Concentration

          0.5-1.5 mg/mL

          Purification

          Affinity chromatography

          Storage buffer

          proprietary buffer, pH 7.4-7.8, with 0.5% BSA, 30% glycerol

          Contains

          0.02% sodium azide

          Storage conditions

          -20°C, store in dark

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Target Information

          Adenine nucleotide translocator (ANT) and the voltage-dependent anion-selective channel proteins 1 and 2 (VDAC1 and VDAC2) are components of the permeability transition pore complex (PTPC) of the mitochondrial inner and outer membranes, respectively. Formation of PTPCs, the subsequent dissipation of mitochondrial inner membrane potential and release of cytochrome c through the outer mitochondrial membrane are critical events in the early stages of apoptosis. Bax, a proapoptotic protein, has been shown to act upon ANT to induce the dissipation of mitochondrial inner membrane potential. ANT1 has a role in the maintenance of mitochondrial DNA by catalyzing the exchange of ADP and ATP across the mitochondrial inner membrane.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Adenine nucleotid translocator 2 fibroblast isoform (ATP-ADP carrier protein); Adenine nucleotid translocator 2, fibroblast isoform (ATP-ADP carrier protein); Adenine nucleotide translocator 2; adenine nucleotide translocator 2 (fibroblast); adenine nucleotide translocator 2 fibroblast isoform (ATP-ADP carrier protein); adenine nucleotide translocator 2, fibroblast isoform (ATP-ADP carrier protein); ADP,ATP carrier protein 2; ADP,ATP carrier protein, fibroblast isoform; ADP/ATP translocase 2; ANT 2; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5; Solute carrier family 25 member 5

          View more View less

          Gene Aliases: 2F1; AAC2; ANT2; SLC25A5; T2; T3

          View more View less

          UniProt ID: (Human) P05141, (Rat) Q09073, (Mouse) P51881

          View more View less

          Entrez Gene ID: (Human) 292, (Rat) 25176, (Mouse) 11740

          View more View less

          Function(s)
          structural constituent of ribosome protein binding adenine transmembrane transporter activity ubiquitin protein ligase binding poly(A) RNA binding transporter activity
          Process(es)
          chromosome segregation positive regulation of cell proliferation transmembrane transport negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway translation transport adenine transport viral process regulation of insulin secretion
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-5fd7d668bc-tpg7z:80/100.66.134.75:80.
          git-commit: 4d16a52b65a0a59161c0e81e148ee2d2ac6d3307
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: integration/2.33.0-meta-desc