Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • 14-3-3 zeta Antibodies

          Invitrogen

          14-3-3 zeta Polyclonal Antibody

          Advanced Verification
          View all (34) 14-3-3 zeta antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite 14-3-3 zeta Polyclonal Antibody

          • Antibody Testing Data (6)
          • Advanced Verification (1)
          14-3-3 zeta Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          14-3-3 zeta Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          14-3-3 zeta Antibody (PA5-80245) in ICC/IF

          Immunofluorescence analysis of YWHAZ was performed using 70% confluent log phase PC-3 cells. The cells were fixed with 4% Paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 10 minutes, and blocked with 2% BSA for 10 minutes at room temperature. The cells were labeled with PLP1 Monoclonal Antibody (plpc 1) (Product # PA5-80245) at 1:250 dilution in 0.1% BSA, incubated at 4 degree cels... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          14-3-3 zeta Antibody in Immunocytochemistry (ICC/IF)
          14-3-3 zeta Antibody in Immunocytochemistry (ICC/IF)
          14-3-3 zeta Antibody in Western Blot (WB)
          14-3-3 zeta Antibody in Western Blot (WB)
          14-3-3 zeta Antibody in Western Blot (WB)
          14-3-3 zeta Antibody in Western Blot (WB)
          14-3-3 zeta Antibody

          Product Details

          PA5-80245

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747359

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human HepG2 whole cell, human THP-1 whole cell, human Raji whole cell, human A549 whole cell, human A431 whole cell, human PC-3 whole cell, human MCF-7 whole cell, human SiHa whole cell, rat brain tissue, rat kidney tissue, rat RH35 whole cell, rat PC-12 whole cell, mouse brain tissue, mouse kidney tissue, mouse ANA-1 whole cell, mouse Neuro-2a whole cell. ICC/IF: U2OS cell.

          Target Information

          At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells. Although more than seven isoforms of 14-3-3 have been described, some redundancies have appeared upon sequencing. The 14-3-3s are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. By interacting with Cdc25C, 14-3-3 regulates entry into the cell cycle and through interaction with Bad, prevents apoptosis. Other proteins that have been shown to bind to 14-3-3s include members of the protein kinase C family, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf and the IGF-1 receptor. Detection of 14-3-3 proteins in cerebrospinal fluid has been shown to be useful in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 14-3-3 delta; 14-3-3 protein zeta/delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 zeta; 1433Z; 143Z; epididymis luminal protein 4; epididymis secretory protein Li 3; epididymis secretory protein Li 93; KCIP-1; Mitochondrial import stimulation factor S1 subunit; phospholipase A2; Protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; SEZ-2; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide

          View more View less

          Gene Aliases: 1110013I11Rik; 14-3-3-zeta; 14-3-3z; 14-3-3zeta; AI596267; AL022924; AU020854; HEL-S-3; HEL-S-93; HEL4; KCIP-1; Msfs1; YWHAD; YWHAZ

          View more View less

          UniProt ID: (Human) P63104, (Mouse) P63101, (Rat) P63102

          View more View less

          Entrez Gene ID: (Human) 7534, (Mouse) 22631, (Rat) 25578

          View more View less

          Function(s)
          protein binding transcription factor binding protein kinase binding protein domain specific binding ubiquitin protein ligase binding identical protein binding poly(A) RNA binding cadherin binding involved in cell-cell adhesion protein complex binding
          Process(es)
          protein targeting signal transduction platelet activation negative regulation of apoptotic process regulation of mRNA stability establishment of Golgi localization membrane organization Golgi reassembly cell-cell adhesion positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway histamine secretion by mast cell protein targeting to mitochondrion regulation of cell death response to drug
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-89bfcd4dd-zgn5p:80/100.66.134.75:80.
          git-commit: f1ed3cb73da2dc18796bd96aca0ec275a318700b
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.33.0-2025.07.30-1.0