Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SLC12A3 (aa 844-988) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102376
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55969. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The SLC12A3 gene encodes the thiazide-sensitive sodium-chloride symporter (NCC), which is critical for salt balance and blood pressure regulation in humans. This symporter is predominantly expressed in the distal convoluted tubule of the kidney, where it facilitates the reabsorption of sodium and chloride ions from the renal filtrate back into the bloodstream. NCC activity plays a vital role in maintaining extracellular fluid volume and potassium homeostasis, impacting systemic blood pressure. Mutations in SLC12A3 can lead to Gitelman syndrome, a hereditary salt-wasting disorder characterized by hypokalemic metabolic alkalosis, low blood pressure, and hypomagnesemia. This gene is regulated by the renin-angiotensin system, which modulates NCC activity through phosphorylation mediated by WNK kinases, thereby affecting renal sodium handling and blood pressure modulation. Research highlights the therapeutic potential of targeting NCC with thiazide diuretics to treat hypertension, emphasizing its importance in both physiological and pathological contexts. The dynamic regulation of NCC by hormonal pathways underscores its significance in fluid and electrolyte balance, contributing to cardiovascular health.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: chemokine (C-C); CK-beta-10; CKb10; MCP-4; MGC17134; Na-Cl cotransporter; Na-Cl symporter; NaCl electroneutral thiazide-sensitive cotransporter; NCC; NCC-1; NCC1; SCYA13; SCYL1; solute carrier family 12 (sodium/chloride transporter), member 3; Solute carrier family 12 member 3; thiazide-sensitive Na-Cl cotransporter; Thiazide-sensitive sodium-chloride cotransporter
Gene Aliases: NCC; NCCT; SLC12A3; TSC
UniProt ID: (Human) P55017
Entrez Gene ID: (Human) 6559
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support