Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PIK3R6 (aa 636-741) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-93428
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PAAPVTDHTCLNVNVTEVVKSSNLAGKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
p87PIKAP (p87 PI3K adapter protein), also known as PIK3R6 (phosphoinositide-3-kinase, regulatory subunit 6), p84 or HsT41028, is a 754 amino acid cytoplasmic protein that functions as a regulatory subunit of the PI 3-kinase p110 complex. Expressed in heart, dendritic cells, macrophages and neutrophils, p87PIKAP drives PI 3-kinase p110 activation, interacts with PDE3B and is thought to cause the two proteins to form a scaffolding interaction. The gene encoding p87PIKAP maps to human chromosome 17, which comprises over 2.5% of the human genome and encodes over 1, 200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Like p53, BRCA1 is directly involved in DNA repair, though specifically it is recognized as a genetic determinant of early onset breast cancer and predisposition to cancers of the ovary, colon, prostate gland and fallopian tubes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: p84 PI3K adapter protein; p84 PIKAP; p87 phosphoinositide 3-kinase gamma (PI3Kg) adapter protein; p87 PI3K adapter protein; p87PIKAP; Phosphoinositide 3-kinase gamma adapter protein of 87 kDa; Phosphoinositide 3-kinase regulatory subunit 6; phosphoinositide-3-kinase, regulatory subunit 6; PI3Kgamma adapter protein of 87 kDa
Gene Aliases: C17orf38; HsT41028; p84 PIKAP; p87(PIKAP); p87PIKAP; PIK3R6
UniProt ID: (Human) Q5UE93
Entrez Gene ID: (Human) 146850
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support