Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human Apolipoprotein L3 Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-105919
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65168. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Apolipoproteins are protein components of plasma lipoproteins. The apolipoprotein L gene family encodes six highly homologous proteins designated apoL1-6, which are associated with large high density type lipoproteins (HDL). The human apoL family maps to chromosome 22q12.1-13.1 within a 127,000 bp region. apoL2 and apoL3 may allow the binding of lipids to organelles or may be involved in the movement of lipids in the cytoplasm. apoL2 localizes to the cytoplasm and is widely expressed, with the highest levels observed in the lung, thymus, pancreas, placenta, adult brain and prostate. The apoL2 protein is also detected in the spleen, liver, kidney, colon, small intestine, uterus, spinal cord, adrenal gland, salivary gland, trachea, mammary gland, skeletal muscle, testis and fetal brain and liver. apoL3 also localizes to the cytoplasm and is widely expressed, with highest levels detected in the prostate, lung and placenta. It is also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland. Lower levels of apoL3 are observed in the brain, heart, fetal liver, pancreas and testis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ApoL-III; apolipoprotein L, 3; Apolipoprotein L-III; Apolipoprotein L3; CG12-1; CG12_1; OTTHUMP00000028913; TNF-inducible protein CG12-1
Gene Aliases: apoL-III; APOL3; APOLIII; CG121; CG12_1
UniProt ID: (Human) O95236
Entrez Gene ID: (Human) 80833
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support